PC Games, Software, Gift Cards and more - Shop Online at G2A.COM

Sign in / Register

Continue with FacebookContinue with PayPalSign in
By clicking Continue with Google, Facebook, or PayPal, you agree to G2A's Terms & Conditions and Privacy Policy.
Don't have an account?Register
    A Way Out Origin Key GLOBAL (ENGLISH ONLY) - 1
    A Way Out Origin Key GLOBAL (ENGLISH ONLY) - 1
    A Way Out Origin Key GLOBAL (ENGLISH ONLY) - 2
    A Way Out Origin Key GLOBAL (ENGLISH ONLY) - 3
    A Way Out Origin Key GLOBAL (ENGLISH ONLY) - 4

    A Way Out Origin Key GLOBAL (ENGLISH ONLY)

    Można aktywować w:


    Sprawdź ograniczenia krajowe





    Join a cooperative experience like none you have seen before. A Way Out, developed by the Hazelight Studios led by a film director Josef Fares, is a story of two men who escaped from prison and need to stay together to f ...

    Czytaj więcej
    Oferta od sprzedawcy
    Cena z Plusem
    57.05 PLN142.28 PLN-60%
    63.39 PLN142.28 PLN-55%
    Gwarancja zwrotu pieniędzydla produktów cyfrowych dostarczanych przez sprzedawców
    • A Way Out Origin Key GLOBAL (ENGLISH ONLY)
      Random PREMIUM 5 Keys Steam Key GLOBAL
      68.91 PLN

      Oszczędzasz: 263.14 PLN

    • Oferty natychmiastowej dostawy

      Sortuj według:

      • 0
        62.40 PLN
      • 0
        63.39 PLN
      • 0
        71.27 PLN
      • 0
        86.84 PLN
      • 0
        88.03 PLN
      • 0
        89.17 PLN
      • 0
        89.61 PLN
      Pokaż 3 więcej ofert

      • Join a cooperative experience like none you have seen before. A Way Out, developed by the Hazelight Studios led by a film director Josef Fares, is a story of two men who escaped from prison and need to stay together to fulfil their motivations

        Unforgettable cooperative gameplay of A Way Out

        Hazelight's game is exclusively two-player co-op. Each player takes control over one of two clearly defined, fully-realised characters Leo and Vincent. Play through the story in carefully directed split-screen, changing display proportions depending on whose part is more essential to the scene.

        Scene-defining decisions

        At its essence A Way Out is a game of decisions and communication. Each scene is filled with opportunities either Leo or Vincent can exploit to shift the odds in their favour, and at numerous times you and your co-player will need to agree on the course of action before progressing.Whether locally or online, A Way Out puts emphasis on communication. Can you reach a compromise satisfying to both of you and push the two escaped convicts through another part of their journey? Your cooperation has direct impact on the event unfolding in the game. What will your choices be, then?

        Controls and animations tailor made for each scene

        In the vein of the Telltale Games' productions and Dontnod's Life is Strange, A Way Out has deeply contextualised control scheme, making each interaction meaningful and given a full motion capture treatment to make it as believable as possible.Take your pick of gameplay-affecting actions which may help you escape of execute a perfect robbery, and actions giving more flavour and character to the two protagonists, providing insight into their personalities and interests. All actions are meaningful, even the smallest ones.

        A Way out story

        The story of A Way Out begins in the USA in the 1970s, when a man called Vincent is thrown in prison where a younger Leo is already an unsatisfied resident. The two discover a common motivation and escape together, which is only the beginning of a long and perilous trip across America.Two men contrast significantly: Leo is a hothead and more spontaneous, while Vincent is older and more eager to talk his way out.Which one of them will be your preferred pick for the game? Each offers a different set of choices and interactions, fully reflecting their personalities.

        No recycling

        A Way Out doesn't cut corners. Each scene and each sequence is unique, complete with unique animations made specifically for it, unused anywhere else. Don't expect repetitive and familiar sections reoccurring during the game, it's not that kind of experience.No canned animations, no generic interactions. Every step of A Way Out is unique.

      • Niemiecki
      G2A Plus - premium benefits and special offers

      Get bonus discounts and a free game each month!

      Unlock membership
      G2A Plus
      G2A LOOT - PC game loot cases

      Pop some cases open and see what you'll end up with. Get cool games for cheap!

      Go to G2A Loot
      G2A loot
      G2A Goldmine - affiliate program

      Share links to marketplace products to make extra money in a fast and easy way!

      Start earning now
      G2A goldmine
      Payment methods:paysafecardvisamastercardskrilldiscoverpaypaland 200+ more

      G2A.COM Limited 31/F, Tower Two, Times Square, 1 Matheson Street
      Causeway Bay, Hong Kong
      Incorporation number: 2088957
      Business registration number: 63264201

      Customer (support) services are granted by G2A PL Sp. z o.o.
      G2A PL Sp. z o.o.
      53 Emilii Plater Street
      00-113 Warsaw

      G2A.COM FacebookG2A.COM TwitterG2A.COM YoutubeG2A.COM InstagramG2A.COM  LinkedInG2A.COM TwitchG2A.COM Reddit image

      Use of this Web site constitutes acceptance of the Terms and Conditions and Privacy policy. All copyrights, trade marks, service marks belong to the corresponding owners.