PC Games, Software, Gift Cards and more - Shop Online at G2A.COM

Sign in / Register

Welcome!
Continue with FacebookContinue with PayPalSign in
By clicking Continue with Google, Facebook, or PayPal, you agree to G2A's Terms & Conditions and Privacy Policy.
Don't have an account?Register
    Crusader Kings II - The Song of Roland Ebook Steam Key GLOBAL - 1
    1/1
    Crusader Kings II - The Song of Roland Ebook Steam Key GLOBAL - 1
    Crusader Kings II - The Song of Roland Ebook Steam Key GLOBAL - 2
    Crusader Kings II - The Song of Roland Ebook Steam Key GLOBAL - 3
    Crusader Kings II - The Song of Roland Ebook Steam Key GLOBAL - 4

    Crusader Kings II - The Song of Roland Ebook Steam Key GLOBAL

    Można aktywować w:

    Poland

    Sprawdź ograniczenia krajowe

    Rodzaj:

    Key

    Wersja:

    GLOBAL

    To celebrate the release of the Charlemagne expansion for Crusader Kings 2, Paradox Books releases this classic epic poem The Song of Roland, in ebook format.The Song of Roland (La Chanson de Roland in French) is a story ...

    Czytaj więcej
    Oferta od sprzedawcy
    Cena z Plusem
    7.76 PLN9.44 PLN-18%
    Cena
    8.63 PLN9.44 PLN-9%
    Gwarancja zwrotu pieniędzydla produktów cyfrowych dostarczanych przez sprzedawców
    • Oferty natychmiastowej dostawy

      Sortuj według:

      • 0
        6.73 PLN
      • 0
        6.79 PLN
      • 0
        8.63 PLN
      • 0
        8.99 PLN
      • 0
        9.06 PLN
      • 0
        9.12 PLN
      • 0
        9.12 PLN
      Pokaż 2 więcej ofert

      • To celebrate the release of the Charlemagne expansion for Crusader Kings 2, Paradox Books releases this classic epic poem The Song of Roland, in ebook format.The Song of Roland (La Chanson de Roland in French) is a story of heroism based on the Battle of Roncevaux in 778, in the reign of Charlemagne. Believed to be written in the 11th century, it is one of the oldest surviving major works in French literature.


        This translation by Charles Kenneth Moncrieff is in the public domain. It includes a new preface by Jakob Munthe, the brand manager for Crusader Kings II at Paradox Interactive.

        Data wydania: 2014-10-14

      • Niemiecki
        Hiszpański
        Francuski
        Angielski
      • Ograniczenia:

        PEGI 12
      G2A Plus - premium benefits and special offers

      Get bonus discounts and a free game each month!

      Unlock membership
      G2A Plus
      G2A LOOT - PC game loot cases

      Pop some cases open and see what you'll end up with. Get cool games for cheap!

      Go to G2A Loot
      G2A loot
      G2A Goldmine - affiliate program

      Share links to marketplace products to make extra money in a fast and easy way!

      Start earning now
      G2A goldmine
      Payment methods:paysafecardvisamastercardskrilldiscoverpaypaland 200+ more

      G2A.COM Limited 31/F, Tower Two, Times Square, 1 Matheson Street
      Causeway Bay, Hong Kong
      Incorporation number: 2088957
      Business registration number: 63264201

      Customer (support) services are granted by G2A PL Sp. z o.o.
      Address:
      G2A PL Sp. z o.o.
      53 Emilii Plater Street
      00-113 Warsaw

      G2A.COM FacebookG2A.COM TwitterG2A.COM YoutubeG2A.COM InstagramG2A.COM  LinkedInG2A.COM TwitchG2A.COM Reddit image

      Use of this Web site constitutes acceptance of the Terms and Conditions and Privacy policy. All copyrights, trade marks, service marks belong to the corresponding owners.