PC Games, Software, Gift Cards and more - Shop Online at G2A.COM
Advertisement
SPONSORED
Inkulinati

Inkulinati

Inkulinati is an ink-based strategy game straight from medieval manuscripts, where a rabbit’s bum can be deadlier than a dog's sword. Take your turn in Inkulinati duels filled with unexpected tactical depth (and humour!)...
Read more
  • Loading...
  • Loading...
  • Loading...
  • Loading...
  • Loading...
  • Loading...
Best price
6.00 PLN
Price with G2A Plus
5.40 PLN

Inkulinati Price Comparison

Sort by
Advertisement
SPONSORED

About Inkulinati

Inkulinati is an ink-based strategy game straight from medieval manuscripts, where a rabbit’s bum can be deadlier than a dog's sword. Take your turn in Inkulinati duels filled with unexpected tactical depth (and humour!). Embark on an ever-changing journey, build your own bestiary, defeat medieval superstars and collect perks to unleash special powers. Become a master of the Living Ink, grab your quill and build your unique strategy time after time so that you can be named the greatest Inkulinati of all time!

Inkulinati

Key Features

  • INKULINATI IS INSPIRED BY REAL-LIFE MEDIEVAL MARGINALIA - 700 years in the making, finally these bizarre art pieces can come alive in a video game and show that medieval people also had their “memes” and that they laughed from the same silly things that we do today. You’ll see sword-wielding rabbits, dogs with spears, trumpets lodged in bottoms, human-eating snails, and more. Much, much more

  • FIGHT LIKE AN INKULINATI - Inkulinati are a legendary group who battle one another on the pages of medieval manuscripts. They fight by drawing Beasts with the Living Ink. Thanks to this magical substance, those creatures come to life and an epic battle ensues.Move your Beasts across the battlefield, perform actions on or with them, make tactical use of obstacles and collect more Living Ink to draw new Beasts which allows you to gain an advantage over your opponent.
  • MULTIPLE DEADLY (AND BIZARRE) BEASTS TO UNLOCK - Donkeys playing trumpets with their bottoms, bishop cats vanquishing heretics with prayers, heavy but deadly snails that eat units alive, and more. Much, much more. They all have their special skills and are waiting for your command.
  • SPECIAL, BATTLE TIDE-TURNING ACTIONS PERFORMED BY THE INKULINATI - It’s not just your Beasts that can cause havoc and damage. Use your fists to smash your opponent's units, draw obstacles to create barriers, relocate your units with a move of your finger, or explode your troops to create pure, pure chaos. Just remember - your opponent can do it too.
  • ADAPT YOUR TACTIC TO EVERY BATTLE - Each Inkulinati has its own army, with different Beasts, who in turn, have different abilities, strengths, and unfortunately, weaknesses (or fortunately - depending which side you’re on). But it’s not just the armies that can influence who will win any given duel. Each Battlefield is its own domain, with its own particular dangers that you should watch out for, and opportunities that you can use. You will have to use your wits and adapt your strategy to beat the opposing Inkulinati’s army on each specific Battlefield.
  • A SINGLE-PLAYER CAMPAIGN - Uncover the mystery and secrets of Inkulinati and face such opponents as Death, Dante Alighieri, and more. Go out into the world and start your adventure! Fight the biggest Inkulinati masters in the land, tame the untamed Beasts, build your ultimate army, try to bring back your Master from the clutches of death, and most importantly, finish your grand quest with the biggest party that the middle ages have ever seen! Howza!!!
  • CREATE AND DEVELOP YOUR OWN CHARACTER - As any aspiring Inkulinati Master, you will get to create your own Tiny-Inkulinati. During your journey you will learn the secret techniques of drawing new Beasts and Inkulinati Hand Actions, allowing you to choose the composition of your army. You can be a brave knight that has no fear and will send his loyal troops straight at his opponents. Or perhaps you would like to play with a bit more tact? In that case, you can be a nun who with the power of prayer can confuse her enemies and heal thy own servants. Those styles, and more, are waiting to be discovered and made your own. Express yourself!
  • EVERY BATTLE HAS ITS OWN STORY - To mark every battle in history books for all future generations to see, a procedurally generated text describes the dramatic (or hilarious) events in detail just above the battlefield.
  • LOCAL PVP BATTLES - Inkulinati will bring you back to the Golden Era of hot-seat mode.

Reviews

Check what our customers think of this title

There are no reviews for this item yet

Add the first review and get a 5% discount for your next purchase
Signed-in customers with at least 1 purchase can review
G2A PLUS FREE

Join Plus Free and get an 11% discount to use right away

Dialog info image

You’ve joined Plus Free!

Now you can collect Plus Points and use them to pay less.

Check your email for the 11% discount code.

By selecting Sign in and join, you agree to receive marketing emails from G2A.COM Limited about deals, promotions, and discounts. You can unsubscribe anytime.
paysafecardvisamastercardskrilldiscoverpaypal

and 200+ other payment methods

ENPLN

Install the G2A app

Get great deals on games wherever you go!

4.6   -  113,300 votes

G2A.COM Android AppG2A.COM on AppStore

  • G2A.COM Limited (platform operator)
  • Address:
    31/F, Tower Two, Times Square, 1 Matheson Street, Causeway Bay, Hong Kong
  • Business registration number:
    63264201
  • G2A LLC (platform operator)
  • Address:
    701 South Carson Street, Suite 200, Carson City, Nevada 89701, USA
  • Business registration number:
    E0627762014-7
  • GATE READY Limited (platform operator)
  • Address:
    31/F, Tower Two, Times Square, 1 Matheson Street, Causeway Bay, Hong Kong
  • Business registration number:
    76175940
Using the G2A.COM platform constitutes acceptance of the
G2A Terms and Conditions
. Information on how we process your personal data can be found in the
Privacy and Cookies Policy
. Copyright © G2A Group. All rights reserved.