PC Games, Software, Gift Cards and more - Shop Online at G2A.COM

Binary Domain Steam Gift EUROPE

  • Binary Domain Steam Gift EUROPE - 1
  • Binary Domain Steam Gift EUROPE - 2
  • Binary Domain Steam Gift EUROPE - 3
  • Binary Domain Steam Gift EUROPE - 4
  • Binary Domain Steam Gift EUROPE - 5
  • Binary Domain Steam Gift EUROPE - 6
  • Binary Domain Steam Gift EUROPE - 7
  • Binary Domain Steam Gift EUROPE - 8
  • Binary Domain Steam Gift EUROPE - 9
  • Binary Domain Steam Gift EUROPE - 10
  • Binary Domain Steam Gift EUROPE - 11
1/11

Platform: Steam

Cannot be activated in United States

Region: EUROPE

Steam Gift Link

Add the game via Link

Binary Domain in this immersive and atmospheric squad-based shooter in which you need to regain control of a futuristic Tokyo from an emerging robotic threat. Set in 2080, the story starts when Dan Marshall and his sq...

SPONSORED

Information about the ad

This is a sponsored offer

  • Presented on behalf of:
    PLYXA, UNIPESSOAL LDA
  • Paid for by:
    PLYXA, UNIPESSOAL LDA
  • Why you see this ad?
    • You searched for similar offers
    • You displayed similar items
    • It matches your recent activity on G2A.COM
  • 99%
    Positive feedback
  • 24425

Discover new content and enhance your experience with the items below

Reviews

Check what our customers think of this title
Overall item rating
5.0
1 reviews
1 out of 1 (100%) reviewers recommend this item
Rating
Select a row to filter reviews
1
0
2
0
3
0
4
0
5
1
Review this item
Get a 5% discount on your next purchase as a thank you
Signed-in customers with at least 1 purchase can review
1 of 1 review
Sort by:
Aserus42Reviewed on: Mar 14, 2025
5.0Steam
Everything is perfect, fast and simple, good purchase, and the game is underrated, it's really good.
Recommends this item
Yes
Verified purchase

Was this review helpful?
0
0
Advertisement
SPONSORED

Get inspired by our articles!

Best Survival Horror Games of All Time

The survival horror genre is broad and popular, and not just because both survival games and horror...

Best G2A Gaming Deals This Month - Save Big Today!

Looking to score great games without overspending? Check out this month’s best G2A deals

15 Games to Push Your Gaming Skills to the Limit (And Maybe Beyond)

Are you ready for the ultimate gaming challenge? Explore our list of games that will push your skills to the...

Best PC Games of 2024: A Complete Yearly Recap

Explore the top PC games of 2024! From action-packed adventures to stunning RPGs, discover the year’s must-play titles.

G2A PLUS FREE

Join Plus Free and get an 11% discount to use right away

Dialog info image

You’ve joined Plus Free!

Now you can collect Plus Points and use them to pay less.

Check your email for the 11% discount code.

By selecting Sign in and join, you agree to receive marketing emails from G2A.COM Limited about deals, promotions, and discounts. You can unsubscribe anytime.
paysafecardvisamastercardskrilldiscoverpaypal

and 200+ other payment methods

ENPLN

Install the G2A app

Get great deals on games wherever you go!

4.6   -  113,300 votes

G2A.COM Android AppG2A.COM on AppStore

  • G2A.COM Limited (platform operator)
  • Address:
    31/F, Tower Two, Times Square, 1 Matheson Street, Causeway Bay, Hong Kong
  • Business registration number:
    63264201
  • G2A LLC (platform operator)
  • Address:
    701 South Carson Street, Suite 200, Carson City, Nevada 89701, USA
  • Business registration number:
    E0627762014-7
  • GATE READY Limited (platform operator)
  • Address:
    31/F, Tower Two, Times Square, 1 Matheson Street, Causeway Bay, Hong Kong
  • Business registration number:
    76175940
Using the G2A.COM platform constitutes acceptance of the
G2A Terms and Conditions
. Information on how we process your personal data can be found in the
Privacy and Cookies Policy
. Copyright © G2A Group. All rights reserved.

Comments

  • No feedback yet
    0
Check other offers from this seller
This seller issues invoices

Activation check

Our sensors indicate that you are in: countries.

Contact seller

  • No feedback yet
  • 0
You'll get a reply to this email

plus-dark-logo
Premium

G2A Plus members have already saved over 2.1M EUR

  • Even lower prices on most offers
  • Monthly gaming bonuses and rewards
  • Plus Points for every purchase – redeem them for cheaper orders
  • Premium support after your purchase
If you cancel, you'll keep the benefits untill the end of your paid period
Save like a pro, grab bonuses like a legend!

By purchasing a G2A PLUS membership, you acknowledge you've read and agreed to G2A Terms and Conditions. Information on how we process your personal data you will find in the Privacy and Cookies Policy.

As a G2A Plus member, you will be charged periodically depending on the plan you choose. You can cancel your membership anytime by signing in to your G2A.COM account and going to the G2A Plus tab.

Responsibility for the item
The seller hasn’t provided any information yet
G2A Random Weekend