PC Games, Software, Gift Cards and more - Shop Online at G2A.COM

Sign in / Register

Continue with FacebookContinue with PayPalSign in
By clicking Continue with Google, Facebook, or PayPal, you agree to G2A's Terms & Conditions and Privacy Policy.
Don't have an account?Register

    Xbox Game Codes & Keys

    If you're a fan of the Xbox games or know someone who would love to play some of the best XBO titles the gaming world has to offer, we have a proposition for you. Why not try out Xbox redeem code. Thanks to this simple sequence of characters, you'll be able to play the best games Microsoft's console has to offer. Xbox game codes offer you a chance to enter the world of unparalleled entertainment thanks to the robust library of titles available on Xbox One, Xbox Series S/X.  So waste no time and take a look at how you can get the best digital deals today with Xbox One & Series X/S redeem codes.

    Um, what's a redeem code?

    We're glad you're asking. Xbox Digital codes, or keys, are a great way of gaining access to the games offered by Xbox Marketplace. Instead of purchasing the game directly from Microsoft's storefront and downloading it on your console, you buy a key to unlock the game that you can type in anytime you want. There are few reasons you should consider this solution. One - Xbox key makes for an excellent gift. Purchasing the Xbox redeem code for a game you know someone will like is a perfect birthday or Christmas present. Two - redeem codes and keys are often cheaper than actual games, with many digital sales on various digital marketplaces. Speaking of which, you can buy a digital redeem code anywhere you want. You're not limited to sticking to Xbox Marketplace - which you can do, of course. Various online stores offer redeem codes to Xbox One & Seriex X/S video games at exclusive discounts. Why overpay for a game when you can have it cheaper?

    I've got my Xbox key? What do I do now?

    Nothing can be simpler than redeeming an Xbox code. All you have to do is log into your Microsoft account assigned to your Xbox One and Xbox Series X/S console. After that, navigate your account to locate the window in which you can enter the redeem code. Type it in and wait for the game to download. Simple as that!

    Ok, but I'm still not convinced. Why should I choose Xbox redeem codes over the ones offered by PlayStation or Steam?

    Another excellent question and one that we're more than happy to answer. Plenty of other platforms indeed offer their own redeem codes and digital keys. There's nothing wrong with choosing one over the other. As wise people say, "variety is the spice of life." If you're interested in why you should pick Xbox codes, take a look at our list of Xbox titles you'll be able to get with them, including both exclusive games and ones available on other platforms. We're sure that all your doubts will disappear after that.

    • Forza Horizon 4 - drive the fastest cars in stunning sceneries, experiencing the full power of Xbox Seriex X/S visuals.
    • Assassin's Creed: Valhalla - experience the life of a Viking in the latest game in the Assassin's Creed franchise.
    • Fortnite - take on players from all over the world in this free-to-play battle royale phenomenon.
    • Gears 5 - the war against the Locust continues in the 5th installment of the classic Xbox series

    Trending topics

    Popular topics

    Discover all

    Payment methods:paysafecardvisamastercardskrilldiscoverpaypaland 200+ more

    G2A.COM Limited 31/F, Tower Two, Times Square, 1 Matheson Street
    Causeway Bay, Hong Kong
    Incorporation number: 2088957
    Business registration number: 63264201

    Customer (support) services are granted by G2A PL Sp. z o.o.
    G2A PL Sp. z o.o.
    53 Emilii Plater Street
    00-113 Warsaw

    G2A.COM FacebookG2A.COM TwitterG2A.COM YoutubeG2A.COM InstagramG2A.COM  LinkedInG2A.COM TwitchG2A.COM Reddit image

    Use of this Web site constitutes acceptance of the Terms and Conditions and Privacy policy. All copyrights, trade marks, service marks belong to the corresponding owners.