PC Games, Software, Gift Cards and more - Shop Online at G2A.COM

Sign in / Register

Continue with FacebookContinue with PayPalSign in
By clicking Continue with Google, Facebook, or PayPal, you agree to G2A's Terms & Conditions and Privacy Policy.
Don't have an account?Register


    Można aktywować w:


    Sprawdź ograniczenia krajowe





    Fight as a mighty Valkyrie to repel the forces of the underworld from invading the world of Asgard.GameplayIn BPM, all of your actions and the actions of your enemies are tied to the beat of the music. Your enemies perfo ...

    Czytaj więcej
    Oferta od sprzedawcy
    Cena z Plusem
    17.90 PLN81.41 PLN-78%
    19.89 PLN81.41 PLN-76%
    Gwarancja zwrotu pieniędzydla produktów cyfrowych dostarczanych przez sprzedawców
      WRATH: Aeon of Ruin - Steam - Key GLOBAL
      27.34 PLN

      Oszczędzasz: 155.85 PLN

    • Oferty natychmiastowej dostawy

      Sortuj według:

      • 0
        24.33 PLN
      • 0
        19.89 PLN
      • 0
        19.95 PLN
      • 0
        20.07 PLN
      • 0
        22.30 PLN
      • 0
        22.73 PLN
      • 0
        22.92 PLN
      Pokaż 8 więcej ofert

      • Fight as a mighty Valkyrie to repel the forces of the underworld from invading the world of Asgard.


        In BPM, all of your actions and the actions of your enemies are tied to the beat of the music. Your enemies perform a dance-like sequence of attacks to an epic rock opera. BPM is inspired by retro shooters of the 90’s. It is fast, frenetic and rhythmical. You can double jump, dash, rocket jump and bunny hop to evade your opponents.Your goal is to reach the end of randomly generated dungeons, collecting different weapons, abilities and items each time you play. These weapons and abilities can radically alter the way you play, making each playthrough unique.You must defeat 7 bosses to reach the final boss. Each boss moves and attacks in a unique way that you must learn to exploit if you want to succeed. Some attacks require you to jump over fields of lava, some to dodge fast projectiles, some to hold fast for a beat.



        • Shoot, jump and dodge to the beat while battling hordes of enemies.
        • Fight powerful bosses in challenging boss battles that will push you to the edge..
        • Explore randomly generated dungeons..
        • Choose from 5 different characters with unique strengths and weaknesses..
        • Wield a powerful arsenal of weapons, all with different behaviour for firing and reloading to the beat of the soundtrack..
        • Battle a diverse array of enemies, each with unique rhythmic behaviours..
        • Get overpowered and fire shotgun rockets while flying through the air..
        • Utilize abilities that radically alter the way you play the game, from teleport to freezing bolts..
        • Equip over 40 items that buff your character in unique and interesting ways..
        • Experience an epic rock opera soundtrack..
        • Challenge modes for extra gameplay..

        Data wydania: 2020-09-15

      • Poniżej znajdują się minimalne i zalecane specyfikacje systemowe produktu BPM: BULLETS PER MINUTE (PC) - Steam Key - GLOBAL. Ze względu na potencjalne zmiany programistyczne, minimalne wymagania systemowe produktu BPM: BULLETS PER MINUTE (PC) - Steam Key - GLOBAL mogą z czasem ulec zmianie.
      G2A Plus - premium benefits and special offers

      Get bonus discounts and a free game each month!

      Unlock membership
      G2A Plus
      G2A LOOT - PC game loot cases

      Pop some cases open and see what you'll end up with. Get cool games for cheap!

      Go to G2A Loot
      G2A loot
      G2A Goldmine - affiliate program

      Share links to marketplace products to make extra money in a fast and easy way!

      Start earning now
      G2A goldmine
      Payment methods:paysafecardvisamastercardskrilldiscoverpaypaland 200+ more

      G2A.COM Limited 31/F, Tower Two, Times Square, 1 Matheson Street
      Causeway Bay, Hong Kong
      Incorporation number: 2088957
      Business registration number: 63264201

      Customer (support) services are granted by G2A PL Sp. z o.o.
      G2A PL Sp. z o.o.
      53 Emilii Plater Street
      00-113 Warsaw

      G2A.COM FacebookG2A.COM TwitterG2A.COM YoutubeG2A.COM InstagramG2A.COM  LinkedInG2A.COM TwitchG2A.COM Reddit image

      Use of this Web site constitutes acceptance of the Terms and Conditions and Privacy policy. All copyrights, trade marks, service marks belong to the corresponding owners.