PC Games, Software, Gift Cards and more - Shop Online at G2A.COM

Zaloguj się / Załóż konto

Cześć!
Kontynuuj z FacebookKontynuuj z PayPalZaloguj się
Klikając Kontynuuj z Google, Facebook lub PayPal, akceptujesz nasz regulamin i Politykę prywatności.
Nie masz konta?Załóż konto
    GUILTY GEAR XX ACCENT CORE PLUS R Steam Key GLOBAL - 1
    1/1
    GUILTY GEAR XX ACCENT CORE PLUS R Steam Key GLOBAL - 1
    GUILTY GEAR XX ACCENT CORE PLUS R Steam Key GLOBAL - 2
    GUILTY GEAR XX ACCENT CORE PLUS R Steam Key GLOBAL - 3
    GUILTY GEAR XX ACCENT CORE PLUS R Steam Key GLOBAL - 4

    GUILTY GEAR XX ACCENT CORE PLUS R Steam Key GLOBAL

    Można aktywować w:

    Polska

    Sprawdź ograniczenia krajowe

    Rodzaj:

    Klucz

    Wersja:

    GLOBALNY

    Ultimate battle action!Using the previous installation, "GUILTY GEAR XX ΛCORE CORE" as the base, players can perform "Gatling combos" by simply pressing attack buttons in sequence; or launch their opponents into mid-air ...

    Czytaj więcej
    Oferta od sprzedawcy
    • GUILTY GEAR XX ACCENT CORE PLUS R Steam Key GLOBAL
      GUILTY GEAR Xrd -REVELATOR- Deluxe Edition + REV2 Deluxe (All DLCs included) All-in-One - Steam - Key GLOBAL
      56.95 PLN

      Oszczędzasz: 299.15 PLN

    • Oferty natychmiastowej dostawy

      Sortuj według:

      • 0
        9.39 PLN
      • 0
        9.82 PLN
      • 0
        9.82 PLN
      • 0
        9.89 PLN
      • 0
        10.70 PLN
      • 0
        11.40 PLN
      • 0
        13.72 PLN
      Pokaż 12 więcej ofert

      • Ultimate battle action!
        Using the previous installation, "GUILTY GEAR XX ΛCORE CORE" as the base, players can perform "Gatling combos" by simply pressing attack buttons in sequence; or launch their opponents into mid-air with the overhead "Dust" attack; or cancelling their character's current motion to allow for more follow-ups with the "Roman Cancel"; keeping everything that makes a GUILTY GEAR game, while fine-tuning everything to reach optimal balance!

        Full 25 characters cast!
        Accent Core Plus marks the return of fan favorites Kliff Undersn and Justice, rounding out the cast of 25 playable characters. And in the latest Plus R version, they have been fine-tuned for more competitive play!

        Refined skills, polished strategies
        Based on the large amount of players' feedbacks on the previous installation, "GUILTY GEAR XX ΛCORE CORE", all characters have been closely examined and further tweaked for optimal battle performance! The entire cast have their core concepts revised and re-evaluated; balances are in place to bring out the most variation among the cast, with the ultimate aim to liven up the heat of every battle! Devise new strategies with each character as you play!

        Multiple game modes
        All-time favorites "Survival Mode", "M.O.M. Mode", "Training Mode" and "Mission Mode" all included! In addition, you can view over 100 special illustrations in the "Gallery Mode" by various artists!

        Ranked Match & Player Match Online Modes
        Players can test their strength online, with the 2 network matching modes "Ranked Match" and "Player Match"! Raise your rank with each win from the "Ranked Match" mode! Or, you can simply have fun online with your friends with the "Player Match"! Wins and losses are not recorded here, so you don't have to worry about a bad record!

        Data wydania: 2015-05-26

      • Poniżej znajdują się minimalne i zalecane specyfikacje systemowe produktu GUILTY GEAR XX ACCENT CORE PLUS R Steam Key GLOBAL. Ze względu na potencjalne zmiany programistyczne, minimalne wymagania systemowe produktu GUILTY GEAR XX ACCENT CORE PLUS R Steam Key GLOBAL mogą z czasem ulec zmianie.
      • Portugalski-Brazylijski
        Niemiecki
        Hiszpański
        Francuski
        Włoski
        Japoński
        Koreański
        Portugalski
        Angielski
      • Deskryptory treści:

        Violence
      G2A Plus - premium benefits and special offers

      Get bonus discounts and a free game each month!

      Unlock membership
      G2A Plus
      G2A LOOT - PC game loot cases

      Pop some cases open and see what you'll end up with. Get cool games for cheap!

      Go to G2A Loot
      G2A loot
      G2A Goldmine - affiliate program

      Share links to marketplace products to make extra money in a fast and easy way!

      Start earning now
      G2A goldmine
      Payment methods:paysafecardvisamastercardskrilldiscoverpaypaland 200+ more

      G2A.COM Limited 31/F, Tower Two, Times Square, 1 Matheson Street
      Causeway Bay, Hong Kong
      Incorporation number: 2088957
      Business registration number: 63264201

      Customer (support) services are granted by G2A PL Sp. z o.o.
      Address:
      G2A PL Sp. z o.o.
      53 Emilii Plater Street
      00-113 Warsaw

      G2A.COM FacebookG2A.COM TwitterG2A.COM YoutubeG2A.COM InstagramG2A.COM  LinkedInG2A.COM TwitchG2A.COM Reddit image

      Use of this Web site constitutes acceptance of the Terms and Conditions and Privacy policy. All copyrights, trade marks, service marks belong to the corresponding owners.