PC Games, Software, Gift Cards and more - Shop Online at G2A.COM
Categories
Garry's Mod Steam Key GLOBAL - 1
1/1
Garry's Mod Steam Key GLOBAL - 1
Garry's Mod Steam Key GLOBAL - 2
Garry's Mod Steam Key GLOBAL - 3
Garry's Mod Steam Key GLOBAL - 4

Garry's Mod Steam Key GLOBAL

Platform:

Steam

See activation guide

Can activate in:

Denmark

Check country restrictions

Type:

Key

Version:

GLOBAL

Garry's Mod is hard to define. It is basically a commercial modification of the source engine. In practice, it means that you get a huge workshop at your disposal. You can create various objects, connect them with each o ...

Read More
offer from seller

Plus price

13.66EUR

Price

15.18EUR
MONEY BACK GUARANTEEfor digital products, offered by seller
  • Bundle 1 of 2

    Garry's Mod Steam Key GLOBAL
    World of Warcraft Time Card 30 Days Battle.net EUROPE
    36.66

    WHAT'S INCLUDED (2)
    Garry's Mod Steam Key GLOBAL
    OFFER FROM: Softwaremedia

    Garry's Mod Steam Key GLOBAL

    Platform: Steam|Version: GLOBAL
    15.18
    World of Warcraft Time Card 30 Days Battle.net EUROPE
    OFFER FROM: Ggameswp

    World of Warcraft Time Card 30 Days Battle.net EUROPE

    Platform: Battle.net|Version: EUROPE
    21.48
  • Sort by:

    15.18EUR
    15.19EUR
    16.86EUR
    18.24EUR
    18.28EUR
    18.48EUR
  • Garry's Mod (PC) for Steam platform is a digital download product – no box included. The price applies to a digital version of the product.

    Note: This mod requires you to have a game with Source engine in your Steam library.

    Bear in mind that after buying this product as a GIFT you will not be able to add it to your inventory.

    Garry's Mod is hard to define. It is basically a commercial modification of the source engine. In practice, it means that you get a huge workshop at your disposal. You can create various objects, connect them with each other or even, create your own game within the game. Virtually, everything is possible in this physics sandbox. Do you think you are not able to create anything unique anymore? This game is going to awake your soul of an artist.

    In Garry's Mod, everything is possible


    The source engine used in Garry's mod is very friendly for modders. The only thing that can actually stop you is your own imagination. If you want to drive a car and simply chill out, you can do it. If you want to change the world of Garry's mod into a Call of Duty like, heavily scripted game with Normandy sequence, you can do it.

    Maybe you want to put a Final Fantasy VII story into this? If you have enough time and imagination, you can do it. To provide you with an example. There is a group of people, who play Hide & Seek in Garry's Mod. The only weird thing is the fact, that they turned themselves into plants and trees. Because why not?

    Garry's Mod gameplay is easy to learn


    Construction sandbox games are very often omitted by players. They are too afraid, that they might not be able to handle the complicated engine. Thus, they rather avoid such games. However, the source engine is different from the others. It is a typical example of easy to learn and hard to master gameplay. After a few minutes, you will be able to build various constructions or force Gordon Freeman to dance. Still, if you are going to try to create more complicated things, like modifications of the engine, then you have to learn. Step by step and you will be able to create something great and unique.

    Key features


    • Building – construct whatever you want. Create a car or a rocket and fly to visit the moon

    • Single or Multiplayer - as far as playing alone is fun, the cooperation with your friends is even more exciting

    • Game modes - It is not only about building things. Thanks to a variety of available modes you can take part in finding the terrorists, running a jail or even playing football.

    • Add-ons - the community creates more and more downloadable additions. You are just a click away from new game features.

    • Physics Gun - Place the ragdolls in any position you want as you can move them around and freeze their limbs

    • Change Ragdolls or NPCs' face – stretch it or enlarge to a great extent. Make them look angry or happy. It's up to you- as everything in the game.

    Release Date: 2006-11-29

  • Below are the minimum and recommended system specifications for Garry's Mod Steam Key GLOBAL. Due to potential programming changes, the minimum system requirements for Garry's Mod Steam Key GLOBAL may change over time.
  • Portugese-Brasil
    Chinese
    Czech
    German
    Spanish
    Finnish
    French
    Italian
    Japanese
    Korean
    Polish
    Portugese
    Russian
    English
  • Restrictions:

    PEGI 3
    ESRB Everyone
    USK 0
G2A Plus - premium benefits and special offers

Get bonus discounts and a free game each month!

Unlock membership
G2A Plus
G2A LOOT - PC game loot cases

Pop some cases open and see what you'll end up with. Get cool games for cheap!

Go to G2A Loot
G2A loot
G2A Goldmine - affiliate program

Share links to marketplace products to make extra money in a fast and easy way!

Start earning now
G2A goldmine
Payment methods:visamastercardpaysafecardpaypaland 200+ more

31/F, Tower Two, Times Square, 1 Matheson Street
Causeway Bay, Hong Kong
Incorporation number: 2088957
Business registration number: 63264201

Customer (support) services are granted by G2A PL Sp. z o.o.
Address:
G2A PL Sp. z o.o.
53 Emilii Plater Street
00-113 Warsaw

G2A.COM FacebookG2A.COM TwitterG2A.COM YoutubeG2A.COM InstagramG2A.COM  LinkedInG2A.COM TwitchG2A.COM Reddit image

Use of this Web site constitutes acceptance of the Terms and Conditions and Privacy policy. All copyrights, trade marks, service marks belong to the corresponding owners.