PC Games, Software, Gift Cards and more - Shop Online at G2A.COM

Sign in / Register

Welcome!
Continue with FacebookContinue with PayPalSign in
By clicking Continue with Google, Facebook, or PayPal, you agree to G2A's Terms & Conditions and Privacy Policy.
Don't have an account?Register
    MXGP 2021 - The Official Motocross Videogame (PC) - Steam Key - GLOBAL - 1
    1/1
    MXGP 2021 - The Official Motocross Videogame (PC) - Steam Key - GLOBAL - 1
    MXGP 2021 - The Official Motocross Videogame (PC) - Steam Key - GLOBAL - 2
    MXGP 2021 - The Official Motocross Videogame (PC) - Steam Key - GLOBAL - 3
    MXGP 2021 - The Official Motocross Videogame (PC) - Steam Key - GLOBAL - 4

    MXGP 2021 - The Official Motocross Videogame (PC) - Steam Key - GLOBAL

    Można aktywować w:

    Poland

    Sprawdź ograniczenia krajowe

    Rodzaj:

    Key

    Wersja:

    GLOBAL

    All the power of Motocross in your hands: the new MXGP 2021 is finally here! The official MXGP videogame is ready to show you what it's made of: warm up your engines and get ready for the most realistic, exciting two-whe ...

    Czytaj więcej
    Oferta od sprzedawcy
    podaruj w prezencie
    Kup produkt i otrzymaj gotowy do pobrania plik PDF na prezent. Sprawdź, jak to działa
    Zobacz oferty od 2 innych sprzedawców
    • Oferty natychmiastowej dostawy

      Sortuj według:

      • 0
        151.58 PLN
      • 0
        151.63 PLN
      • 0
        155.35 PLN
      • 0
        156.08 PLN

      • All the power of Motocross in your hands: the new MXGP 2021 is finally here! The official MXGP videogame is ready to show you what it's made of: warm up your engines and get ready for the most realistic, exciting two-wheeled experience ever!

        MXGP 2021 - The Official Motocross Videogame

        Gameplay and Features

        • CAREER - Strap on your helmet, hop onto your bike and go full throttle on your path to becoming a true MXGP champion. You can create your own team or choose to join an official one, starting from the MX2 category in the new career mode. Your career results will affect game progression, as well as the contracts you can sign with teams and sponsors.
        • LOST IN REALITY - Everything is so realistic in MXGP 2021 that it's easy to get confused.More than 40 riders, plus the official MXGP and MX2 2021 season bikes and teams. Sponsors, accessories and all the 2021 championship tracks. Plus three iconic tracks from past competitions: Ottobiano (Italy), Ernee (France) and Leon (Mexico). With MXGP 2021, you'll feel like you're riding your bike instead of watching in front of a screen!
        • MAKE YOUR MARK ON THE FUN - Make your dreams come true, letting your imagination run wild with the track editor: choose the terrain type, build the track and customise every aspect of your dream track. Share your crazy achievements online and download the most exciting tracks created by other players.
        • NO LIMIT CUSTOMISATION - With more than 100 authentic brands, there are endless possible customisation combinations for bikes and riders. Make your mark on Motocross and add your own special touch to the game!
        • PLAYGROUND 2.0 - A fantastic new Playground lets you explore new landscapes and hone your riding skills. You can create your own route by placing multiple checkpoints in sequence in Waypoint mode: race and challenge your friends online.
        • MULTIPLAYER - Online competitions are taking on new horizons: now you can challenge your opponents on custom tracks. You can also create your own events and interact with other players in Race Director mode. Are you up to the challenge?

        Data wydania: 2021-11-30

      • Poniżej znajdują się minimalne i zalecane specyfikacje systemowe produktu MXGP 2021 - The Official Motocross Videogame (PC) - Steam Key - GLOBAL. Ze względu na potencjalne zmiany programistyczne, minimalne wymagania systemowe produktu MXGP 2021 - The Official Motocross Videogame (PC) - Steam Key - GLOBAL mogą z czasem ulec zmianie.
      G2A Plus - premium benefits and special offers

      Get bonus discounts and a free game each month!

      Unlock membership
      G2A Plus
      G2A LOOT - PC game loot cases

      Pop some cases open and see what you'll end up with. Get cool games for cheap!

      Go to G2A Loot
      G2A loot
      G2A Goldmine - affiliate program

      Share links to marketplace products to make extra money in a fast and easy way!

      Start earning now
      G2A goldmine
      Payment methods:paysafecardvisamastercardskrilldiscoverpaypaland 200+ more

      G2A.COM Limited 31/F, Tower Two, Times Square, 1 Matheson Street
      Causeway Bay, Hong Kong
      Incorporation number: 2088957
      Business registration number: 63264201

      Customer (support) services are granted by G2A PL Sp. z o.o.
      Address:
      G2A PL Sp. z o.o.
      53 Emilii Plater Street
      00-113 Warsaw

      G2A.COM FacebookG2A.COM TwitterG2A.COM YoutubeG2A.COM InstagramG2A.COM  LinkedInG2A.COM TwitchG2A.COM Reddit image

      Use of this Web site constitutes acceptance of the Terms and Conditions and Privacy policy. All copyrights, trade marks, service marks belong to the corresponding owners.